DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3402 and TAX1BP3

DIOPT Version :9

Sequence 1:NP_612045.1 Gene:CG3402 / 38077 FlyBaseID:FBgn0035148 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_055419.1 Gene:TAX1BP3 / 30851 HGNCID:30684 Length:124 Species:Homo sapiens


Alignment Length:104 Identity:47/104 - (45%)
Similarity:66/104 - (63%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ITLHKEKDYDQEGREILKCGFKIGGGIDQDYKKSP--QGYTDYGIYVTEVHEGSPAARAGLRIHD 83
            :.:||.:    :|..:: .||.||||||||..::|  :..||.|||||.|.||.||..|||:|.|
Human    16 VEIHKLR----QGENLI-LGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGD 75

  Fly    84 KILQCNGYDFTMVTHKKAVSYI--RKNPILNMLVARKGV 120
            ||:|.||:|.|||||.:|...:  |...::.:||.|:.:
Human    76 KIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3402NP_612045.1 PDZ_signaling 21..116 CDD:238492 45/98 (46%)
TAX1BP3NP_055419.1 PDZ_signaling 13..109 CDD:238492 44/97 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146538
Domainoid 1 1.000 79 1.000 Domainoid score I8736
eggNOG 1 0.900 - - E1_KOG3553
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5191
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471323at2759
OrthoFinder 1 1.000 - - FOG0007400
OrthoInspector 1 1.000 - - oto90043
orthoMCL 1 0.900 - - OOG6_108303
Panther 1 1.100 - - LDO PTHR23136
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2940
SonicParanoid 1 1.000 - - X5525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.