powered by:
Protein Alignment CG3402 and Slc9a3r2
DIOPT Version :9
Sequence 1: | NP_612045.1 |
Gene: | CG3402 / 38077 |
FlyBaseID: | FBgn0035148 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_446263.2 |
Gene: | Slc9a3r2 / 116501 |
RGDID: | 620380 |
Length: | 337 |
Species: | Rattus norvegicus |
Alignment Length: | 63 |
Identity: | 20/63 - (31%) |
Similarity: | 35/63 - (55%) |
Gaps: | 8/63 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 KKSPQGY--------TDYGIYVTEVHEGSPAARAGLRIHDKILQCNGYDFTMVTHKKAVSYIR 106
::.|||| :..|.|:..|..||||:.:|||..|::::.||.:...:.|.:.|:.|:
Rat 155 RRGPQGYGFNLHSDKSRPGQYIRSVDPGSPASLSGLRAQDRLIEVNGQNVEGLRHAEVVARIK 217
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.