DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3402 and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_612045.1 Gene:CG3402 / 38077 FlyBaseID:FBgn0035148 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_446263.2 Gene:Slc9a3r2 / 116501 RGDID:620380 Length:337 Species:Rattus norvegicus


Alignment Length:63 Identity:20/63 - (31%)
Similarity:35/63 - (55%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KKSPQGY--------TDYGIYVTEVHEGSPAARAGLRIHDKILQCNGYDFTMVTHKKAVSYIR 106
            ::.||||        :..|.|:..|..||||:.:|||..|::::.||.:...:.|.:.|:.|:
  Rat   155 RRGPQGYGFNLHSDKSRPGQYIRSVDPGSPASLSGLRAQDRLIEVNGQNVEGLRHAEVVARIK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3402NP_612045.1 PDZ_signaling 21..116 CDD:238492 20/63 (32%)
Slc9a3r2NP_446263.2 PDZ_signaling 9..88 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..146
PDZ_signaling 149..228 CDD:238492 20/63 (32%)
EBP50_C 232..337 CDD:401087
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.