DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and GAE2

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_171702.1 Gene:GAE2 / 839289 AraportID:AT1G02000 Length:434 Species:Arabidopsis thaliana


Alignment Length:356 Identity:95/356 - (26%)
Similarity:152/356 - (42%) Gaps:51/356 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDIT 69
            :|||||.||::|:|....:...|..|:.:||..:.|.:..|    .||...:....|.....||.
plant    93 SVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLK----RSRQALLERSGVFIVEGDIN 153

  Fly    70 DREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTG-TNVLLEAMADNNVFKFVYSSS 133
            |...::.:|:......|.|.||...|..:...|..|.|:|:.| .|:|....:.|.....|::||
plant   154 DLSLLKKLFEVVPFTHVMHLAAQAGVRYAMENPGSYVHSNIAGFVNLLEVCKSANPQPAIVWASS 218

  Fly   134 ATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEI------LKDLCKSDKRWAVVSLRYFNPVGA 192
            ::|||....:|.:|:..|....|.|..||...|||      :..|       ::..||:|...| 
plant   219 SSVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGL-------SLTGLRFFTVYG- 275

  Fly   193 HISGRIGEDPNGEPNNLMPYI---AQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVK 254
                     |.|.|:  |.|.   ..:..|:  ::|::..   .:.||..||:.:|.|:.:|.:.
plant   276 ---------PWGRPD--MAYFFFTRDILKGK--AISIFEG---ANHGTVARDFTYIDDIVKGCLG 324

  Fly   255 ALD----------KLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVD-RRSGDVA 308
            |||          |.|..|:...|  |||......|.|:|...|:....|....::. .|:|||.
plant   325 ALDTAEKSTGSGGKKRGAAQLRVF--NLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVP 387

  Fly   309 TCYADATLADKKLGWKAERGIDKMCEDTWRW 339
            ..:|:.:.|.::.|:|....:....:...||
plant   388 FTHANISSAQREFGYKPSTDLQTGLKKFVRW 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 95/356 (27%)
galE 6..343 CDD:273487 95/355 (27%)
GAE2NP_171702.1 NADB_Rossmann 94..422 CDD:419666 95/355 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.