DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and UGE1

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_172738.1 Gene:UGE1 / 837834 AraportID:AT1G12780 Length:351 Species:Arabidopsis thaliana


Alignment Length:349 Identity:184/349 - (52%)
Similarity:239/349 - (68%) Gaps:11/349 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITG----KKVNFYRV 66
            :|||||||:||:|||:::|..|:.|..:||..|:      :.||:.||:|:.|    ||::|...
plant     9 ILVTGGAGFIGTHTVVQLLKDGFKVSIIDNFDNS------VIEAVDRVRELVGPDLSKKLDFNLG 67

  Fly    67 DITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYS 131
            |:.::..:..:|.:.:.|.|.|||.|||||||...|.:|:.||:.||..|.|.||..|....|:|
plant    68 DLRNKGDIEKLFSKQRFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYETMAKYNCKMMVFS 132

  Fly   132 SSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISG 196
            |||||||:|:.:|..|:... ...:|||:||.|.|||.:|:.|::..|.::.||||||||||.||
plant   133 SSATVYGQPEKIPCMEDFEL-KAMNPYGRTKLFLEEIARDIQKAEPEWRIILLRYFNPVGAHESG 196

  Fly   197 RIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDKLRN 261
            .|||||.|.||||||||.||||||.|.|:|||.|:||.||:.||||||::|||:||:.||.||..
plant   197 SIGEDPKGIPNNLMPYIQQVAVGRLPELNVYGHDYPTEDGSAVRDYIHVMDLADGHIAALRKLFA 261

  Fly   262 IAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKLGWKAE 326
            ..:.|..|||||||.|.|||:||.|||||||||:...|..|||||....||....|:|:|||||:
plant   262 DPKIGCTAYNLGTGQGTSVLEMVAAFEKASGKKIPIKLCPRRSGDATAVYASTEKAEKELGWKAK 326

  Fly   327 RGIDKMCEDTWRWQSQNPNGYANK 350
            .|:|:||.|.|:|.:.||.||.||
plant   327 YGVDEMCRDQWKWANNNPWGYQNK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 178/338 (53%)
galE 6..343 CDD:273487 178/340 (52%)
UGE1NP_172738.1 PLN02240 2..350 CDD:177883 182/347 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 362 1.000 Domainoid score I192
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I523
OMA 1 1.010 - - QHG54544
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 1 1.000 - - FOG0001696
OrthoInspector 1 1.000 - - otm2458
orthoMCL 1 0.900 - - OOG6_100506
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.