DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and CRB

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001322308.1 Gene:CRB / 837455 AraportID:AT1G09340 Length:379 Species:Arabidopsis thaliana


Alignment Length:358 Identity:80/358 - (22%)
Similarity:126/358 - (35%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGK----------K 60
            :|:.||..:||......::..|:.|       ..::.| |.|.|    :::.|:          |
plant    57 ILIMGGTRFIGLFLSRILVKEGHQV-------TLFTRG-KSPIA----KQLPGESDQDFADFSSK 109

  Fly    61 VNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNV--LLEAMADN 123
            :...:.|..|.:.|:|.......|:|                  |..|......|  :|||:.  
plant   110 ILHLKGDRKDYDFVKSSLSAEGFDVV------------------YDINGREAEEVEPILEALP-- 154

  Fly   124 NVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFN 188
            .:.:::|.|||.||.:...||..||......:...||.:  ||.:|:   .....|  .|:|   
plant   155 KLEQYIYCSSAGVYLKSDILPHCEEDAVDPKSRHKGKLE--TESLLQ---SKGVNW--TSIR--- 209

  Fly   189 PVGAHISGRIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPT-HDGTGVRDYIHIVDLAE-- 250
            ||  :|.|.:..:|..|     .:..::..||         ..|. :.|..:....|:.|||.  
plant   210 PV--YIYGPLNYNPVEE-----WFFHRLKAGR---------PIPVPNSGIQISQLGHVKDLATAF 258

  Fly   251 ----GHVKALDKLRNIAETGFFAYNLGTGVGYSVLD-MVKAFEKAS-----------------GK 293
                |:.||..::.||           :|..|...| :.||..||.                 ||
plant   259 LNVLGNEKASREIFNI-----------SGEKYVTFDGLAKACAKAGGFPEPEIVHYNPKEFDFGK 312

  Fly   294 KVNYTLVDRRSGDVATCYADATLADKKLGWKAE 326
            |..:...|:.      .:|....|...||||.|
plant   313 KKAFPFRDQH------FFASVEKAKHVLGWKPE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 80/358 (22%)
galE 6..343 CDD:273487 80/358 (22%)
CRBNP_001322308.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43725
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.