DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and DUR

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_199261.1 Gene:DUR / 834475 AraportID:AT5G44480 Length:436 Species:Arabidopsis thaliana


Alignment Length:348 Identity:144/348 - (41%)
Similarity:193/348 - (55%) Gaps:17/348 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITD 70
            |||||||||||||..|.:|...|.|..||||........|   .|.::...|| ::.|...|:.|
plant    97 VLVTGGAGYIGSHAALRLLRDSYRVTIVDNLSRGNLGAVK---TLQQLFPQTG-RLQFIYADLGD 157

  Fly    71 REQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSSAT 135
            ...|..:|.|:..|.|.||||:..||||...||:||||..:.|..:|||||.:.|.|.:|||:..
plant   158 PLAVEKIFSENAFDAVMHFAAVAYVGESTLYPLKYYHNITSNTLGVLEAMARHKVKKLIYSSTCA 222

  Fly   136 VYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISGRIGE 200
            .||||:.:|:||:.|... .:||||.|...|:::.|..|:.. .||:.|||||.:|:...||:||
plant   223 TYGEPEKMPITEDTPQVP-INPYGKAKKMAEDMILDFSKNSD-MAVMILRYFNVIGSDPGGRLGE 285

  Fly   201 DPN---GEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDKL--R 260
            .|.   .|...:.......|.|..|.|.|.|:|:.|.|||.:||||.:.||.:.|||||:|.  |
plant   286 APRPELREQGRISGACFDAARGFIPGLQVKGTDYKTSDGTCIRDYIDVTDLVDAHVKALEKAQPR 350

  Fly   261 NIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKLGWKA 325
            .:.     .||:|||.|.||.:.|:|.:||:|.::....:.||.||.|..|:|.|...|.|.|.|
plant   351 KVG-----IYNVGTGKGRSVKEFVEACKKATGVEIKVDFLPRRPGDYAEVYSDPTKILKDLNWTA 410

  Fly   326 E-RGIDKMCEDTWRWQSQNPNGY 347
            . ..:....:..||||..:|:||
plant   411 RFTNLQDSLQVAWRWQKIHPHGY 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 140/340 (41%)
galE 6..343 CDD:273487 141/342 (41%)
DURNP_199261.1 UDP_G4E_1_SDR_e 96..427 CDD:187558 140/340 (41%)
galE 97..429 CDD:273487 141/342 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100506
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.