DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and GME

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001190417.1 Gene:GME / 833002 AraportID:AT5G28840 Length:377 Species:Arabidopsis thaliana


Alignment Length:358 Identity:83/358 - (23%)
Similarity:131/358 - (36%) Gaps:76/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITD 70
            :.:||..|:|.||....:.:.|:.||..|...|.:.:.....:             .|:.||:..
plant    30 ISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCD-------------EFHLVDLRV 81

  Fly    71 REQVRSVFQ--EHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSS 133
            .|....|.:  :|..::.|....:..:..:..:.:  |:|.|...| ::||...|.:.:|.|:||
plant    82 MENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIM--YNNTMISFN-MIEAARINGIKRFFYASS 143

  Fly   134 ATVYGEPKFLPVTEEHPTGNCTSP------YGKTKYFTEEILKDLCKSDKRWAVVSLR------Y 186
            |.:|.|.|.|..|......:...|      ||..|..|||    |||...:...:..|      .
plant   144 ACIYPEFKQLETTNVSLKESDAWPAEPQDAYGLEKLATEE----LCKHYNKDFGIECRIGRFHNI 204

  Fly   187 FNPVGAHISGRIGEDPNGEPNNLMPYIAQVAVGRRPSLS-----VYGSDFPTHDGTGVRDYIHIV 246
            :.|.|....||              ..|..|..|:...|     ::|      ||...|.:..|.
plant   205 YGPFGTWKGGR--------------EKAPAAFCRKAQTSTDRFEMWG------DGLQTRSFTFID 249

  Fly   247 DLAEGHVKALDKLR-----NIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGD 306
            :..|| |..|.|..     ||......:.|       .:.:||.:||:   ||:....:....| 
plant   250 ECVEG-VLRLTKSDFREPVNIGSDEMVSMN-------EMAEMVLSFEE---KKLPIHHIPGPEG- 302

  Fly   307 VATCYADATLADKKLGWKAERGIDKMCEDTWRW 339
            |....:|..|..:||||.....:.:....|:.|
plant   303 VRGRNSDNNLIKEKLGWAPNMRLKEGLRITYFW 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 83/358 (23%)
galE 6..343 CDD:273487 83/358 (23%)
GMENP_001190417.1 PLN02695 7..377 CDD:178298 83/358 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.