DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and AT4G20460

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_193779.2 Gene:AT4G20460 / 827794 AraportID:AT4G20460 Length:411 Species:Arabidopsis thaliana


Alignment Length:354 Identity:144/354 - (40%)
Similarity:193/354 - (54%) Gaps:25/354 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEAL----SRVQEITGKKVNFYRV 66
            |||||||||||||..|.:|...|.|..||||........|:.:.|    .|:|        |...
plant    72 VLVTGGAGYIGSHAALRLLKDSYRVTIVDNLSRGNLGAVKVLQGLFPEPGRLQ--------FIYA 128

  Fly    67 DITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYS 131
            |:.|.:.|..:|.|:..|.|.||||:..||||...||:||||..:.|.|:|||:|.:.|.|.:||
plant   129 DLGDAKAVDKIFSENAFDAVMHFAAVAYVGESTLDPLKYYHNITSNTLVVLEAVARHKVKKLIYS 193

  Fly   132 SSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISG 196
            |:...||||..:|:.|..|... .:||||.|...|:::.|..|:.. .||:.|||||.:|:...|
plant   194 STCATYGEPDKMPIVEVTPQVP-INPYGKAKKMAEDMILDFSKNSD-MAVMILRYFNVIGSDPEG 256

  Fly   197 RIGEDPN---GEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDK 258
            |:||.|.   .|...:.......|.|..|.|.|.|:|:.|.|||.|||||.:.||.:.|||||:|
plant   257 RLGEAPKPELREHGRISGACFDAARGVIPGLQVKGTDYKTGDGTCVRDYIDVTDLVDAHVKALEK 321

  Fly   259 L--RNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKL 321
            .  ||:.     .||:|||.|.||.:.|:|.:||:|..:....:.||.||.|..|:|.....:.|
plant   322 AKPRNVG-----IYNVGTGKGRSVKEFVEACKKATGVDIKVDFLPRRPGDYAEVYSDPAKILRDL 381

  Fly   322 GWKAE-RGIDKMCEDTWRWQSQNPNGYAN 349
            .|.|. ..:.:..|..|:||..:|:|||:
plant   382 NWSARYTNLQESLEVAWKWQKTHPHGYAS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 139/344 (40%)
galE 6..343 CDD:273487 140/346 (40%)
AT4G20460NP_193779.2 UDP_G4E_1_SDR_e 71..402 CDD:187558 139/344 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100506
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.