DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and CSP41A

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_191873.1 Gene:CSP41A / 825489 AraportID:AT3G63140 Length:406 Species:Arabidopsis thaliana


Alignment Length:343 Identity:66/343 - (19%)
Similarity:117/343 - (34%) Gaps:86/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEIT--------GKKVNFYR 65
            :||...||.:...|:|:||: .:.:..:.:..|...|.| ..:|..||.        |...|   
plant    89 SGGHAVIGFYFAKELLSAGH-AVTILTVGDESSEKMKKP-PFNRFSEIVSGGGKTVWGNPAN--- 148

  Fly    66 VDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVY 130
                                ||:...    ||:..:.|.....::.....:::....:.|.:|::
plant   149 --------------------VANVVG----GETFDVVLDNNGKDLDTVRPVVDWAKSSGVKQFLF 189

  Fly   131 SSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHIS 195
            .|||.:|..      ||:.|                .:..|..|:|....||........|...|
plant   190 ISSAGIYKS------TEQPP----------------HVEGDAVKADAGHVVVEKYLAETFGNWAS 232

  Fly   196 GR----IGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKAL 256
            .|    ||...|.:....  :..::.  |..::.:.||.....:.:.|||...::..|..:.:|.
plant   233 FRPQYMIGSGNNKDCEEW--FFDRIV--RDRAVPIPGSGLQLTNISHVRDLSSMLTSAVANPEAA 293

  Fly   257 DKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVAT----------CY 311
            .  .||       :|..:....::..|.|....|:||.|.....|.::..|..          .|
plant   294 S--GNI-------FNCVSDRAVTLDGMAKLCAAAAGKTVEIVHYDPKAIGVDAKKAFLFRNMHFY 349

  Fly   312 ADATLADKKLGWKAERGI 329
            |:...|...|||:::..:
plant   350 AEPRAAKDLLGWESKTNL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 66/343 (19%)
galE 6..343 CDD:273487 66/343 (19%)
CSP41ANP_191873.1 PLN00016 59..406 CDD:215029 66/343 (19%)
NADB_Rossmann 80..333 CDD:304358 59/307 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43725
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.