DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and GAE6

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_189024.1 Gene:GAE6 / 821965 AraportID:AT3G23820 Length:460 Species:Arabidopsis thaliana


Alignment Length:340 Identity:100/340 - (29%)
Similarity:146/340 - (42%) Gaps:49/340 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDIT 69
            :|||||.||::|||..|.:...|..|:..||..:.|....|    .:|.:.:..::|.....|:.
plant   113 SVLVTGAAGFVGSHCSLALRKRGDGVLGFDNFNDYYDPSLK----RARQELLEKQQVFIVEGDLN 173

  Fly    70 DREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTG-TNVLLEAMADNNVFKFVYSSS 133
            |...:|.:|.......:.|.||...|..:.:.|..|..:|:.| .|:|..|.|.|.....|::||
plant   174 DGPLLRKLFDVVPFTHILHLAAQAGVRYAMKNPQSYIASNIAGFVNLLEVAKAANPQPAIVWASS 238

  Fly   134 ATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEI------LKDLCKSDKRWAVVSLRYFNPVGA 192
            ::|||.....|.:|||.|....|.|..||...|||      :..|       ::..||:|...| 
plant   239 SSVYGLNTENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGL-------SLTGLRFFTVYG- 295

  Fly   193 HISGRIGEDPNGEPNNLMPYI---AQVAVGRRPSLSVYGSDFPTHDGTGV-RDYIHIVDLAEGHV 253
                     |.|.|:  |.|.   ..:..|:  |:.:|    .|.|...| ||:.:|.|:.:|.|
plant   296 ---------PWGRPD--MAYFFFTKDILHGK--SIDIY----RTQDNQEVARDFTYIDDIVKGCV 343

  Fly   254 KALDKLRNIAETG--------FFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDR-RSGDVAT 309
            .|||.......:|        ...||||......|..:|...|...|.|....|:.. |:|||..
plant   344 GALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPY 408

  Fly   310 CYADATLADKKLGWK 324
            .:|:.:||.|..|:|
plant   409 THANVSLAYKDFGYK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 100/340 (29%)
galE 6..343 CDD:273487 100/339 (29%)
GAE6NP_189024.1 NADB_Rossmann 114..439 CDD:419666 100/339 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.