DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and GAE4

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_182056.1 Gene:GAE4 / 819139 AraportID:AT2G45310 Length:437 Species:Arabidopsis thaliana


Alignment Length:356 Identity:104/356 - (29%)
Similarity:158/356 - (44%) Gaps:51/356 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDIT 69
            ||||||.||::|:|....:...|..||.:||..:.|....|  .|...:.|.:|  :.....||.
plant    98 TVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPSLK--RARRALLERSG--IFIVEGDIN 158

  Fly    70 DREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTG-TNVLLEAMADNNVFKFVYSSS 133
            |.|.:|.:|:......|.|.||...|..:...|..|.|:|:.| .|:|....:.|.....|::||
plant   159 DVELLRKLFKIVSFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLLEICKSVNPQPAIVWASS 223

  Fly   134 ATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEI------LKDLCKSDKRWAVVSLRYFNPVGA 192
            ::|||....:|.:|:..|....|.|..||...|||      :..|       ::..||:|...| 
plant   224 SSVYGLNTKVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGL-------SLTGLRFFTVYG- 280

  Fly   193 HISGRIGEDPNGEPNNLMPYI---AQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVK 254
                     |.|.|:  |.|.   ..:..|:  |:|::.|   .:.||..||:.:|.|:.:|.:.
plant   281 ---------PWGRPD--MAYFFFTKDILKGK--SISIFES---ANHGTVARDFTYIDDIVKGCLA 329

  Fly   255 ALD----------KLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDR-RSGDVA 308
            |||          |.|..|:...|  |||......|.|:|:..|:....|....|:.. |:|||.
plant   330 ALDTAEKSTGSGGKKRGPAQLRVF--NLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVP 392

  Fly   309 TCYADATLADKKLGWKAERGIDKMCEDTWRW 339
            ..:|:.:||.::||:|....:....:...||
plant   393 FTHANISLAQRELGYKPTTDLQTGLKKFVRW 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 104/356 (29%)
galE 6..343 CDD:273487 103/355 (29%)
GAE4NP_182056.1 UDP_GE_SDE_e 97..427 CDD:187563 104/356 (29%)
WcaG 99..428 CDD:223528 103/355 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.