DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and MEE25

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001324451.1 Gene:MEE25 / 818050 AraportID:AT2G34850 Length:236 Species:Arabidopsis thaliana


Alignment Length:234 Identity:91/234 - (38%)
Similarity:133/234 - (56%) Gaps:9/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 MADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSL 184
            ||.:.|...:|||:...||||:.:|:|||.|... .:||||.|...|:|:.|..| :...||:.|
plant     1 MAAHGVKTLIYSSTCATYGEPEKMPITEETPQVP-INPYGKAKKMAEDIILDFSK-NSIMAVMIL 63

  Fly   185 RYFNPVGAHISGRIGEDPN---GEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIV 246
            ||||.:|:...||:||.|.   .|...:.......|.|..|.|.:.|:|:.|.|||.|||||.:.
plant    64 RYFNVIGSDPEGRLGEAPRPELSEHGRISGACFDAARGIIPGLQIKGTDYKTVDGTCVRDYIDVT 128

  Fly   247 DLAEGHVKALDKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCY 311
            ||.:.|||||:|.:. .:.|.|  |:|||.|.||.:.|:|.:||:|..:....::||:||.|..|
plant   129 DLVDAHVKALEKAKP-RKVGIF--NVGTGKGSSVKEFVEACKKATGVDIKVDYLERRAGDYAEVY 190

  Fly   312 ADATLADKKLGWKAER-GIDKMCEDTWRWQSQNPNGYAN 349
            :|.....::|.|.|:. .:.:..:..||||..:.:||.:
plant   191 SDPRKIKEELNWTAKHTNLQESLKMAWRWQKLHRSGYGS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 88/224 (39%)
galE 6..343 CDD:273487 89/226 (39%)
MEE25NP_001324451.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D662484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100506
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.