DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gale and Uxs

DIOPT Version :9

Sequence 1:NP_001246537.1 Gene:Gale / 38076 FlyBaseID:FBgn0035147 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster


Alignment Length:348 Identity:89/348 - (25%)
Similarity:149/348 - (42%) Gaps:74/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITD 70
            :|:|||||::|||.|.:::..|:.||.|||    :.:|.|     ..|:...|.: ||   ::..
  Fly   118 ILITGGAGFVGSHLVDDLMVQGHEVIVVDN----FFTGRK-----RNVEHWLGHE-NF---ELIH 169

  Fly    71 REQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGT-NVLLEAMADNNVFKFVYSSSA 134
            .:.|..:|.|  ||.:.|.|:..:.......|::....|..|| |||  .:|...:.|.:.:|::
  Fly   170 HDIVNPLFIE--IDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVL--GLAKRVMAKVLIASTS 230

  Fly   135 TVYGEPKFLPVTEEH-----PTG--NCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGA 192
            .|||:|...|..|.:     |.|  .|   |.:.|..:|.:.....|.:|....|: |.||..|.
  Fly   231 EVYGDPTVHPQPETYWGHVNPIGPRAC---YDEGKRVSETLSYAYAKQEKVQVRVA-RIFNTYGP 291

  Fly   193 HI---SGRIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVK 254
            .:   .||:          :..:|.|..  |..:::|||      :|...|.:.::.||.:|.:.
  Fly   292 RMHMNDGRV----------VSNFILQAL--RNETITVYG------NGKQTRSFQYVSDLVDGMIA 338

  Fly   255 ALDKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGK----KVNYTLVD---RRSGDVATCYA 312
            .:      |.......|||..|..::.:..:..:|..|.    |.:..:.|   ||..|:     
  Fly   339 LM------ASNYTQPVNLGNPVEQTIGEFAEIIKKLVGGPSVIKQSKAMEDDPQRRKPDI----- 392

  Fly   313 DATLADKKLGWK----AERGIDK 331
              |.|.:.|.|:    .|.|:.:
  Fly   393 --TRARQLLHWEPKVPLETGLQR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaleNP_001246537.1 UDP_G4E_1_SDR_e 5..341 CDD:187558 89/348 (26%)
galE 6..343 CDD:273487 89/348 (26%)
UxsNP_648182.1 WcaG 116..424 CDD:223528 89/348 (26%)
UGD_SDR_e 116..419 CDD:187541 89/348 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.