DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and HDHD3

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001291438.1 Gene:HDHD3 / 81932 HGNCID:28171 Length:251 Species:Homo sapiens


Alignment Length:249 Identity:70/249 - (28%)
Similarity:124/249 - (49%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNPQ 70
            :.||:|:||.:|||:.|...|:.|.......|...:.:.|.:.|:..:...:..:||:|  .:..
Human     6 QIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYG--LSHG 68

  Fly    71 MEWQQWWRKLIAGTF-------AESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLR 128
            :..:|||..::..||       |::.|.|.::...:||:        ...||..:|:.:.|    
Human    69 LTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSH--------PCTWQVLDGAEDTL---- 121

  Fly   129 KELKPEKCKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLK 193
            :|.:....:|.||:|||.||..:|....|.::.||.:.|......||||:|||:|:.   |.:::
Human   122 RECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALR---LAHME 183

  Fly   194 PEECLHIGDGPTTDYLAAKELGWHSAL-VHEKSYAYLVKKYGEDIDRDHVFPSL 246
            |....|:||....||...:.:|.||.| |..::...:|:   :.:.::|:.|||
Human   184 PVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVR---DSVPKEHILPSL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 63/218 (29%)
HAD_like 76..215 CDD:304363 42/145 (29%)
HDHD3NP_001291438.1 DREG-2 8..210 CDD:274056 63/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143355
Domainoid 1 1.000 45 1.000 Domainoid score I12263
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2956
OMA 1 1.010 - - QHG55252
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - otm40885
orthoMCL 1 0.900 - - OOG6_102573
Panther 1 1.100 - - LDO PTHR46191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1833
SonicParanoid 1 1.000 - - X2471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.