DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and AT2G41250

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_181658.1 Gene:AT2G41250 / 818724 AraportID:AT2G41250 Length:290 Species:Arabidopsis thaliana


Alignment Length:229 Identity:59/229 - (25%)
Similarity:98/229 - (42%) Gaps:32/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYK-MNRDYPNFGRDTNPQM 71
            :.:..|...|||.......:.|..||..:|......|:...::..:.| ....:..:..|..|  
plant    78 KALLVDAVGTLLVPAQPTAQIYKNIGEKYGVEYSEAEILTRYRRAYQKPWGGSHLRYVNDARP-- 140

  Fly    72 EWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYK---TSICWQPCNGSVELLQQLRKELKP 133
                :|:.::.   |.:|.        :.|.:..|||.   |...|:.|:...   .::.|.:|.
plant   141 ----FWQYIVT---ASTGC--------SDSQYFEELYSYFTTEQAWKLCDPDA---GKVFKAIKE 187

  Fly   134 EKCKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECL 198
            ...|:.:::|||.||..||:..:.:.:.|....|.||:||||:|.||.||.|   |..:.||:.:
plant   188 AGVKVAIVSNFDTRLRPLLRALRCEDWFDAVAVSAEVEAEKPNPTIFLKACE---LLEVNPEDAV 249

  Fly   199 HIGDGPTTDYLAAKELG-----WHSALVHEKSYA 227
            |:||....|...|::.|     |.|.:...|..|
plant   250 HVGDDRRNDVWGARDAGCDAWLWGSEVTSFKQVA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 57/220 (26%)
HAD_like 76..215 CDD:304363 42/141 (30%)
AT2G41250NP_181658.1 DREG-2 78..271 CDD:274056 55/215 (26%)
HAD-SF-IA-v1 <156..266 CDD:273686 38/115 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3574
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2471
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.