DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and ACAD10

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001130010.1 Gene:ACAD10 / 80724 HGNCID:21597 Length:1090 Species:Homo sapiens


Alignment Length:244 Identity:58/244 - (23%)
Similarity:93/244 - (38%) Gaps:61/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNP 69
            |.:|.:.||:...|:   .:||:                     ..|.|...|| .|: |.....
Human    40 STYRAVIFDMGGVLI---PSPGR---------------------VAAEWEVQNR-IPS-GTILKA 78

  Fly    70 QMEWQQ---WWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLR--- 128
            .||..:   |.|.:.|...||.       .|..|.....|:.|||:   |.:....||...|   
Human    79 LMEGGENGPWMRFMRAEITAEG-------FLREFGRLCSEMLKTSV---PVDSFFSLLTSERVAK 133

  Fly   129 ---------KELKPEKCKLGVIANFDPRLPTLLQNTKLD-QYLDFAINSYEVQAEKPDPQIFQKA 183
                     .:::.:..:..|::| :..||.......|| :..|..:.|......||||:|::..
Human   134 QFPVMTEAITQIRAKGLQTAVLSN-NFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLC 197

  Fly   184 MEKSGLKNLKPEECLHIGD-GPTTDYLAAKELGWHSALVHEKSYAYLVK 231
            :|:.|   |:|.|.:.:.| |  |:...|..||.|:  :..:.:|.|.|
Human   198 LEQLG---LQPSESIFLDDLG--TNLKEAARLGIHT--IKRQGFAVLPK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 54/228 (24%)
HAD_like 76..215 CDD:304363 37/152 (24%)
ACAD10NP_001130010.1 HAD-1A3-hyp 41..278 CDD:274054 57/243 (23%)
HAD_like 46..238 CDD:304363 54/235 (23%)
PLN02876 288..1087 CDD:215473
ACAD10_11_N-like 317..567 CDD:270703
ACAD 694..1087 CDD:299127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.