DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and hdhd3

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001072693.1 Gene:hdhd3 / 780150 XenbaseID:XB-GENE-969463 Length:189 Species:Xenopus tropicalis


Alignment Length:146 Identity:46/146 - (31%)
Similarity:71/146 - (48%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNPQME 72
            ||||:|:.:|||:.|...|:||.......|...|...|..:|:..:...:|.:||:|....  |:
 Frog     4 RLITWDIKDTLLRVRVPVGQQYFAEAKRQGLCMDPGSLETSFRNAYRTHSRLFPNYGLAQG--MD 66

  Fly    73 WQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPEKC- 136
            .:|||..::..||..|||. .||.:.:.:..|.:.:.|:..|....|:.|.|         :.| 
 Frog    67 SRQWWLDVVLQTFRLSGAE-DDETVRSVAQQLYQDFSTARNWAVVPGAREAL---------DSCK 121

  Fly   137 ----KLGVIANFDPRL 148
                |:.||:|||.||
 Frog   122 GLGLKMAVISNFDRRL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 46/146 (32%)
HAD_like 76..215 CDD:304363 24/78 (31%)
hdhd3NP_001072693.1 DREG-2 4..>139 CDD:274056 46/146 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - mtm9462
Panther 1 1.100 - - LDO PTHR46191
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.