DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and Nanp

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_038960978.1 Gene:Nanp / 311530 RGDID:1306009 Length:261 Species:Rattus norvegicus


Alignment Length:245 Identity:55/245 - (22%)
Similarity:95/245 - (38%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTN 68
            |||.|.:.||:.|||:.  |....:.|.:.|      |:.:...:..|...|:.:...::..:..
  Rat     3 LSRVRAVFFDLDNTLID--TAGASRRGMLEA------DHIQFILHIPATVIKLLQSKYHYKEEAE 59

  Fly    69 PQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIE----------------LYK-TSICWQP 116
            ...:..|  .||....|......|.|.:..::...:.|                |:| |.:....
  Rat    60 VICDKVQ--VKLSKECFHPYSTCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMT 122

  Fly   117 CNGSVE-LLQQLRKELKPEKCKLGVIANFDPRLPTLLQNTKLD-----QYLDFAINSYEVQAEKP 175
            ....|: :|.:||||:     :|.::.|.|.:    .|..|::     .|.|..:...|.:.|||
  Rat   123 LEEDVKAMLTELRKEV-----RLLLLTNGDRQ----TQREKIEACACQSYFDAIVVGGEQKEEKP 178

  Fly   176 DPQIFQKAMEKSGLKNLKPEECLHIGDGPTTDYLAAKELGWHSALVHEKS 225
            .|.||....:   |..::|.:|:.:||...||.......|..:.:...||
  Rat   179 APSIFYHCCD---LLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 50/234 (21%)
HAD_like 76..215 CDD:304363 36/161 (22%)
NanpXP_038960978.1 CTE7 6..247 CDD:274057 52/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.