DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and EPHX2

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001970.2 Gene:EPHX2 / 2053 HGNCID:3402 Length:555 Species:Homo sapiens


Alignment Length:96 Identity:29/96 - (30%)
Similarity:41/96 - (42%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LLQNTKLD----------------QYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLK--PEEC 197
            :|.||.||                .:.||.|.|.:|...||:|||:     |..|..||  |.|.
Human   121 ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIY-----KFLLDTLKASPSEV 180

  Fly   198 LHIGD-GPTTDYLAAKELGWHSALVHEKSYA 227
            :.:.| |  .:...|::||..:.||.:...|
Human   181 VFLDDIG--ANLKPARDLGMVTILVQDTDTA 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 26/87 (30%)
HAD_like 76..215 CDD:304363 24/82 (29%)
EPHX2NP_001970.2 Phosphatase 1..224 29/96 (30%)
HAD_sEH-N_like 3..214 CDD:319790 29/96 (30%)