DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and K01G5.10

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_499376.1 Gene:K01G5.10 / 186851 WormBaseID:WBGene00010481 Length:248 Species:Caenorhabditis elegans


Alignment Length:240 Identity:60/240 - (25%)
Similarity:110/240 - (45%) Gaps:16/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLSR-------FRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNR 58
            :|:.||       .::::.|..:||:..:.:|...|......:....|::::..:|..|:.:|:.
 Worm     6 LRTTSRNLSTPPVVKVLSLDARDTLITMKESPPIVYSRFARQYDLEVDSDQIMGSFLKNYKRMSI 70

  Fly    59 DYPNFGRDTNPQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVEL 123
            ..|.||.:   .:..:.||.::::.|..:........::...:..|...|.|...|:......  
 Worm    71 ASPCFGFN---GIGNKSWWIEVVSSTLLDCAPDSEKGRVEVIAGALYNHYATPEPWKLVESDT-- 130

  Fly   124 LQQLRKELKPEKCKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSG 188
             :|..::|:.:...|.||:|||.||.:||....|.......:.|.|:..||||.:|||..:....
 Worm   131 -RQTLQKLRLKGIILVVISNFDSRLKSLLSQFNLLDLFSMTVLSGEIGYEKPDEKIFQLVVNHFD 194

  Fly   189 LKNLKPEECLHIGDGPTTDYLAAKELGWHSALVHEKSYAYLVKKY 233
            |  :.|.|.|||||....|:..||..|.. ||:.:.|.::.|:.:
 Worm   195 L--ISPSEILHIGDNLKNDFHGAKNFGCR-ALLFDSSSSHNVEPF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 53/211 (25%)
HAD_like 76..215 CDD:304363 40/138 (29%)
K01G5.10NP_499376.1 DREG-2 20..224 CDD:274056 54/212 (25%)
HAD-SF-IA-v1 21..219 CDD:273686 52/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157544
Domainoid 1 1.000 55 1.000 Domainoid score I7420
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I3711
Isobase 1 0.950 - 0 Normalized mean entropy S2956
OMA 1 1.010 - - QHG55252
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - otm14268
orthoMCL 1 0.900 - - OOG6_102573
Panther 1 1.100 - - LDO PTHR46191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1833
SonicParanoid 1 1.000 - - X2471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.