DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and F45E1.4

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_509345.2 Gene:F45E1.4 / 185793 WormBaseID:WBGene00018465 Length:287 Species:Caenorhabditis elegans


Alignment Length:131 Identity:28/131 - (21%)
Similarity:49/131 - (37%) Gaps:26/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ESGAAIPDEKLHNF------SNHLIELYKTSICWQPCNGSVELLQQLR------KELKPEKCKLG 139
            |..:.:.|..:.:|      :|.|...|...:       |.:|:::|.      ..||....|:.
 Worm   118 EISSLLMDNGIKSFEAREITNNSLTNSYDKIL-------STDLVKELADTVALFTRLKQHGTKIA 175

  Fly   140 VIANFDPRLPTL--LQNTKLDQYLDFAI-NSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHIG 201
            | ...|.|..:|  |:...:|..:|..: ...:..|.||.|....|..:..|:...|   .:.:|
 Worm   176 V-CTADNRKSSLLALKRMNVDHLVDMIVCGDDKNTAPKPSPHNAIKICKHLGVDQSK---AIMVG 236

  Fly   202 D 202
            |
 Worm   237 D 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 28/131 (21%)
HAD_like 76..215 CDD:304363 28/131 (21%)
F45E1.4NP_509345.2 Gph 50..276 CDD:223620 28/131 (21%)
HAD_like 141..248 CDD:119389 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.