DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and bigr-1

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001254294.1 Gene:bigr-1 / 174706 WormBaseID:WBGene00009512 Length:226 Species:Caenorhabditis elegans


Alignment Length:261 Identity:54/261 - (20%)
Similarity:94/261 - (36%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRD--YPNF 63
            |....:.:.:.:|....||.:.....|                         |..|:|.  .|:.
 Worm     1 MTMTQQIKAVVYDFGGVLLSYEGVMEK-------------------------WVAMSRSLGLPDD 40

  Fly    64 G-RDTNPQMEWQQWW---RKLIAGTFA----ESGAAIPDEKLHNFSNHL---IELYKTSICWQPC 117
            . ...:..:|:.||.   |.|..||..    |.|..:...| |.:.|.|   :.:...:.|.:..
 Worm    41 AVHSESVGIEFSQWLGPDRSLFLGTLTVDDLEGGLFLQYLK-HKYGNKLTDNVVIKPFTECLRGE 104

  Fly   118 NGSVELLQQLRKELKPEK-CKLGVIAN--------FDPRLPTLLQNTKLDQYLDFAINSYEVQAE 173
            |..:....|...|:..:| .|..::.|        .:.|||..|  |..|:.::..:.    ...
 Worm   105 NVKIHKNMQKTVEILHKKGFKTAMLTNNMFLDKEHKETRLPCDL--THFDEVVESCLE----HLM 163

  Fly   174 KPDPQIFQKAMEKSGLKNLKPEECLHIGDGPTTDYLAAKELGWHSALVHEKSYAYLVKKYGEDID 238
            |||.:.:....::.|   :||||.:.: |....:..||::|||::.||             |||:
 Worm   164 KPDARFYHLVEKRLG---VKPEEIVFL-DDLHENIEAAEKLGWNTILV-------------EDIE 211

  Fly   239 R 239
            :
 Worm   212 K 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 48/233 (21%)
HAD_like 76..215 CDD:304363 35/157 (22%)
bigr-1NP_001254294.1 HAD-1A3-hyp 6..223 CDD:274054 53/256 (21%)
HAD_like <101..209 CDD:304363 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.