DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and SEC14

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:85/320 - (26%)
Similarity:138/320 - (43%) Gaps:62/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGPLPEISEEQRAILEKFRKQMDDA-LVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMW 64
            :.|....:...|...|.:.||.::|| .:...||..|:|:|||||::::.|::|.....|.|..:
Yeast    22 LPGTPGNLDSAQEKALAELRKLLEDAGFIERLDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDY 86

  Fly    65 NVDNIEK---WDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLL 126
            ..|.|.:   :|....:.::.|......|.:|.||.      |:..|   .|...|..|  |...
Yeast    87 GTDTILQDFHYDEKPLIAKFYPQYYHKTDKDGRPVY------FEELG---AVNLHEMNK--VTSE 140

  Fly   127 ERFMK-IAYDQSQKHGWR-------ARQLV----VFFDMQDVNLKQYAWRPAAECVISTVKQYEA 179
            ||.:| :.::......:|       |..||    ...|::.:::.      :|..|:|.|:  ||
Yeast   141 ERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISIS------SAYSVMSYVR--EA 197

  Fly   180 N------FPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKA 238
            :      :||.:...||||||..||.||.:.|.|||..|.|||.|..|.   :|::|...:..:.
Yeast   198 SYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSS---YQKELLKQIPAEN 259

  Fly   239 FPKAWGGEM-VDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFV--EAQVPKGDKLK 295
            .|..:||:. ||.:.          ||     ||:.......|..::  |.:.|:...:|
Yeast   260 LPVKFGGKSEVDESK----------GG-----LYLSDIGPWRDPKYIGPEGEAPEAFSMK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 16/41 (39%)
SEC14 75..246 CDD:238099 51/188 (27%)
GOLD_2 303..381 CDD:290608
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 16/44 (36%)
SEC14 99..269 CDD:214706 52/191 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1667
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - mtm9225
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1304
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.