DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and AT1G55840

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_175980.1 Gene:AT1G55840 / 842034 AraportID:AT1G55840 Length:325 Species:Arabidopsis thaliana


Alignment Length:344 Identity:82/344 - (23%)
Similarity:138/344 - (40%) Gaps:56/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EISEEQRAILEKFRKQMDDALVGTHDDY---FLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDN 68
            |..::.||::|.....:.::....|..|   .|:|:|:||..|::.|.|||...|:.|....:|.
plant     7 EAVKQLRALMEDVDDSLRESYRNIHQGYPTENLLRFLKARDGNVQKAHKMLLECLEWRTQNEIDK 71

  Fly    69 -----IEKWDPPKALQEYLPYGLMGYDNEGSPVLV--CPFANFDMWGMMHCVTRFEFQKYLVLLL 126
                 |...|..:.:::....|:.||..||.||:.  ...:.:|...:.:.|     |.::.:..
plant    72 ILTKPIVPVDLYRGIRDTQLVGVSGYSKEGLPVIAIGVGLSTYDKASVHYYV-----QSHIQMNE 131

  Fly   127 ERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEA-------NFPEL 184
            .|...:....|:|.|......:...||..:.|.          .:|.:|...|       |:||.
plant   132 YRDRVVLPSASKKQGRPICTCLKILDMSGLKLS----------ALSQIKLMTAITTIDDLNYPEK 186

  Fly   185 LKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKS-GVDRWQEQLFSHVNRKAFPKAWGGEMV 248
            .:..|::|.|.:||..:..:|..|.|.|..||.:.|. |.|    :|...::.::.|     ...
plant   187 TETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKD----ELLKIMDYESLP-----HFC 242

  Fly   249 DRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQ-VPKGDKLKL-HFKVNV-------EE 304
            .|.|....:.:.  .|.:.....:|.|..|...|:|:.| :.||....: |..|:|       |.
plant   243 RREGSGSGRHIS--NGTVDNCFSLDHSFHQDLYDYVKQQALVKGSGAPIRHGSVHVKFPEPDTEG 305

  Fly   305 QKI---LSWEFRTFDYDIK 320
            .||   |..||:....|.|
plant   306 NKIFDTLENEFQKLGNDQK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/43 (30%)
SEC14 75..246 CDD:238099 39/180 (22%)
GOLD_2 303..381 CDD:290608 8/21 (38%)
AT1G55840NP_175980.1 CRAL_TRIO_N 8..59 CDD:397711 15/50 (30%)
SEC14 91..242 CDD:214706 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.