DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and AT1G01630

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_171669.1 Gene:AT1G01630 / 839231 AraportID:AT1G01630 Length:255 Species:Arabidopsis thaliana


Alignment Length:283 Identity:69/283 - (24%)
Similarity:114/283 - (40%) Gaps:73/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPEISEE--------QRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTR 61
            :|.|.:|        .||:.::     .|......||..:.|:||||..::|.|..|....|   
plant    19 VPLIEDEIERSKVGIMRALCDR-----QDPETKEVDDLMIRRFLRARDLDIEKASTMFLNYL--- 75

  Fly    62 AMWNVDNIEKWDPPKA-LQEYLPYGLM---GYDNEGSPVLVCPFANFDMWGMMHCVTR---FEFQ 119
             .|....:.|...|:| :...|.:..|   |:|..|.|:.|.       .|..|..::   .||:
plant    76 -TWKRSMLPKGHIPEAEIANDLSHNKMCMQGHDKMGRPIAVA-------IGNRHNPSKGNPDEFK 132

  Fly   120 KYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQ-----DVNLKQYAWRPAAECVISTVKQYEA 179
            :::|..||:.........:|       .|...|:|     :.:::.|.      ..:||::..  
plant   133 RFVVYTLEKICARMPRGQEK-------FVAIGDLQGWGYSNCDIRGYL------AALSTLQDC-- 182

  Fly   180 NFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWG 244
             :||.|...||::||.:|..|:.::..|:|.||..|||..:              |:|..|... 
plant   183 -YPERLGKLYIVHAPYIFMTAWKVIYPFIDANTKKKIVFVE--------------NKKLTPTLL- 231

  Fly   245 GEMVDRNGDPQCKALMVWGGKLP 267
             |.:|.:..|.     ::|||||
plant   232 -EDIDESQLPD-----IYGGKLP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 11/40 (28%)
SEC14 75..246 CDD:238099 42/182 (23%)
GOLD_2 303..381 CDD:290608
AT1G01630NP_171669.1 CRAL_TRIO_N 29..74 CDD:215024 13/49 (27%)
SEC14 103..246 CDD:238099 42/186 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.