DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and AT1G14820

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_973831.1 Gene:AT1G14820 / 838047 AraportID:AT1G14820 Length:252 Species:Arabidopsis thaliana


Alignment Length:257 Identity:64/257 - (24%)
Similarity:106/257 - (41%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISEEQRAILEKFRKQMDDALVGT--HDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIE 70
            :.|.|...|.:.||.::.....|  :|...|:|:|.||..:...|.||.       ..|     :
plant     1 MEESQELALTQLRKSVEKLSSSTEGYDKPTLMRFLVARSMDPVKAAKMF-------VDW-----Q 53

  Fly    71 KWD----------PPKALQEYLPYG---LMGYDNEGSP-VLVCP---FANFDMWGMMHCVTRFEF 118
            ||.          |...:|:.|.:.   |.|....|.| |||..   ||:.|         ...|
plant    54 KWRASMVPPTGFIPESEVQDELEFRKVCLQGPTKSGHPLVLVITSKHFASKD---------PANF 109

  Fly   119 QKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPE 183
            :|::|..|::.:....:..:..|   .:||...|:.::..|..    .|..:|:..:..::.:||
plant   110 KKFVVYALDKTIASGNNGKEVGG---EKLVAVIDLANITYKNL----DARGLITGFQFLQSYYPE 167

  Fly   184 LLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGG 245
            .|..|||::.|..|...:..|.:||::.|..||||...|.:  |.:....:...|.|:.:||
plant   168 RLAKCYILHMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEE--QRKFEEEIGADALPEEYGG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/42 (31%)
SEC14 75..246 CDD:238099 45/178 (25%)
GOLD_2 303..381 CDD:290608
AT1G14820NP_973831.1 CRAL_TRIO_N 6..51 CDD:215024 13/51 (25%)
SEC14 80..227 CDD:238099 41/164 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.