DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and AT5G63060

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:235 Identity:54/235 - (22%)
Similarity:98/235 - (41%) Gaps:50/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISEEQRA------ILEKFRKQMDDALVGTH--DDYFLVRW-LRARKWNLEAAEKMLRASLKTRAM 63
            :||.|.|      :.|:..|......:|.:  ||..::.| |:.|:::::.|...|..::|.|..
plant    38 VSESQHAHKLVLEVKERLAKDCTSLPLGKYGRDDEDMILWFLKDRRFSVDEAIGKLTKAIKWRHE 102

  Fly    64 WNVDNIEKWDPPKALQEYLPYGLMGY-DNEGSP-VLVCPFANFDMWGMMHCVTRFEFQKYLVLLL 126
            :.||.:.: |..||..:.....:.|: |.:|.| |:|.|..:..  |::..:   |.:|..|.||
plant   103 FKVDELSE-DSIKAATDTGKAYVHGFLDVKGRPVVIVAPAKHIP--GLLDPI---EDEKLCVFLL 161

  Fly   127 ERFM-KIAYDQSQKHGWRARQLVVFFDM-----QDVNLKQYAWRPAAECVISTVKQYEANFPELL 185
            |:.: |:...|        .:::..||:     |:.:||...:       :..|..|  .:|..|
plant   162 EKALSKLPAGQ--------HKILGIFDLRGFGSQNADLKFLTF-------LFDVFYY--YYPSRL 209

  Fly   186 KMCYIINAPKLFSVAFNIVK----------KFLDENTTSK 215
            .....::||.:|...:...|          ||....|..|
plant   210 DEVLFVDAPFIFQPIWQFTKPLVKQYASLVKFCSAETVRK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 10/43 (23%)
SEC14 75..246 CDD:238099 35/159 (22%)
GOLD_2 303..381 CDD:290608
AT5G63060NP_201111.2 SEC14 118..261 CDD:214706 33/154 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.