DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and AT5G47730

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001330995.1 Gene:AT5G47730 / 834824 AraportID:AT5G47730 Length:341 Species:Arabidopsis thaliana


Alignment Length:251 Identity:68/251 - (27%)
Similarity:110/251 - (43%) Gaps:33/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISEEQRAILEKFRKQMDDALVGT----HDDYF---LVRWLRARKWNLEAAEKMLRASLKTRAMWN 65
            :|||.....::...|:::.|..|    |..|.   |.|:|:||.||:..|..||...|:    |.
plant     4 VSEEAIDEFQELMDQVEEPLKKTYERVHQGYLRENLGRFLKARDWNVCKAHTMLVECLR----WR 64

  Fly    66 VDN-----IEKWDPPKAL----QEYLPYGLMGYDNEGSPVLV--CPFANFDMWGMMHCVTRFEFQ 119
            |||     :.|...|..|    ::....|:.||..||.||..  ...:.||...:.:.|     |
plant    65 VDNEIDSILSKPIVPTELYRDVRDSQLIGMSGYTKEGLPVFAIGVGLSTFDKASVHYYV-----Q 124

  Fly   120 KYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPEL 184
            .::.:...|...:....|:|:|......|...||..:.|...: :.....:|||:.  :.|:||.
plant   125 SHIQINEYRDRVLLPSISKKNGRPITTCVKVLDMTGLKLSALS-QIKLVTIISTID--DLNYPEK 186

  Fly   185 LKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFP 240
            ....|::|||.:||..:.:||..|.|.|..|:.:. ||..|  ::|...::..:.|
plant   187 TNTYYVVNAPYIFSACWKVVKPLLQERTRKKVHVL-SGCGR--DELLKIMDFTSLP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 15/47 (32%)
SEC14 75..246 CDD:238099 44/172 (26%)
GOLD_2 303..381 CDD:290608
AT5G47730NP_001330995.1 CRAL_TRIO_N 8..59 CDD:397711 15/50 (30%)
SEC14 91..242 CDD:214706 42/160 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.