DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and AT3G24840

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001327840.1 Gene:AT3G24840 / 822082 AraportID:AT3G24840 Length:580 Species:Arabidopsis thaliana


Alignment Length:247 Identity:72/247 - (29%)
Similarity:118/247 - (47%) Gaps:19/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EEQRAILEKFRKQMD--DALVGTHDDYF-LVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIEK 71
            ||:...:..|||.:.  |.|...||||. ::|:|:||:::||...:|....||.|....||.|.:
plant    75 EEEEKAVNVFRKALVSLDLLPPRHDDYHTMLRFLKARRFDLEKTVQMWEEMLKWRKENGVDTIIQ 139

  Fly    72 ---WDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLERFMKIA 133
               :|..:.:|:|.|:|..|.|.||.||.:......|...:|...|...|.:|.|...|:.....
plant   140 DFVYDEYEEVQQYYPHGYHGVDREGRPVYIERLGKIDPGKLMKVTTLERFLRYHVQGFEKTFSEK 204

  Fly   134 YD----QSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEA-NFPELLKMCYIINA 193
            :.    .:::|   ........|:..|:...:  |..|:.::..:::.:. |:||.|...|||||
plant   205 FPACSIAAKRH---INSSTTIIDVHGVSWMSF--RKLAQDLVMRMQKIDGDNYPETLNQMYIINA 264

  Fly   194 PKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGG 245
            ...|.:.:|.||.|||..|||||.:..   ::::..|...::....|:..||
plant   265 GNGFKLVWNTVKGFLDPKTTSKIHVLG---NKYRSHLLEIIDPSELPEFLGG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 16/43 (37%)
SEC14 75..246 CDD:238099 47/176 (27%)
GOLD_2 303..381 CDD:290608
AT3G24840NP_001327840.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102488
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.