DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and RLBP1

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:272 Identity:58/272 - (21%)
Similarity:117/272 - (43%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPEISEEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNI 69
            |.|:.:.|.|..|:....:.:. |...|..|.:|::||||:|:..|.::||..:..|..:.    
Human    75 LQEMVQAQAASGEELAVAVAER-VQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYP---- 134

  Fly    70 EKWD--PPKALQEYLPYGLMGY----DNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLER 128
            |.:|  .|:|::..:..|..|.    |..|..|::   .|.:.|.... :|..|..:....:||:
Human   135 ELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVML---FNIENWQSQE-ITFDEILQAYCFILEK 195

  Fly   129 FMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQ----YEANFPELLKMCY 189
            .::  .:::|.:|:...:          |.|.:..:.||....|.:::    .:.:||...|..:
Human   196 LLE--NEETQINGFCIIE----------NFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIH 248

  Fly   190 IINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNG-- 252
            .|:.|..|:..:|:||.||......::.::...:..:    :..::....|..:||.:...:|  
Human   249 FIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGF----YQEIDENILPSDFGGTLPKYDGKA 309

  Fly   253 ------DPQCKA 258
                  .||.:|
Human   310 VAEQLFGPQAQA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/40 (33%)
SEC14 75..246 CDD:238099 33/178 (19%)
GOLD_2 303..381 CDD:290608
RLBP1XP_016877949.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.