DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Ttpa

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:265 Identity:61/265 - (23%)
Similarity:115/265 - (43%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PL--PEISEEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNV 66
            ||  |.::|.:|.:.|....|....|.    |.||:|:||||.::|:.|.::::           
Mouse    22 PLLQPGLAELRRRVQEAGVPQTPQPLT----DAFLLRFLRARDFDLDLAWRLMK----------- 71

  Fly    67 DNIEKW--DPPKALQEYLPYGLMGY------------DNEGSPVLVCPFANFDMWGMMHCVTRFE 117
             |..||  :.|:...:..|..::|.            |:.||.||:...|.:|    ....|.::
Mouse    72 -NYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWD----PKVFTAYD 131

  Fly   118 FQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWR--PAAECVISTVKQYEA- 179
            .  :.|.|:...:.:...::|::|.:|     .||::       .|:  .|.:...|..|:..| 
Mouse   132 V--FRVSLITSELIVQEVETQRNGVKA-----IFDLE-------GWQVSHAFQITPSVAKKIAAV 182

  Fly   180 ---NFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPK 241
               :||..::..::||.|.:|...|:::|.||.|....:|.::.:.......|.|..:    .|:
Mouse   183 LTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDI----LPR 243

  Fly   242 AWGGE 246
            .:||:
Mouse   244 EYGGK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/40 (33%)
SEC14 75..246 CDD:238099 39/188 (21%)
GOLD_2 303..381 CDD:290608
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 16/63 (25%)
CRAL_TRIO 99..248 CDD:279044 36/170 (21%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.