DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and mospd2

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001007294.2 Gene:mospd2 / 492327 ZFINID:ZDB-GENE-041114-1 Length:526 Species:Danio rerio


Alignment Length:374 Identity:83/374 - (22%)
Similarity:148/374 - (39%) Gaps:106/374 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIEKWDPP 75
            :.|.:.:.||   |||||   :.|  :.|   |.:.:|...||:..||:.|..::|:::.:...|
Zfish    39 DSRDVEKLFR---DDALV---EGY--LTW---RHFIVEDTLKMIDESLQWRREFSVNDLTESSIP 92

  Fly    76 KALQEYLPYGLMGYDNEGSPVLVCPFANFDMW--GMMHC---VTRFEFQKYLVLLLERFMKIAYD 135
            :.:.|.....|.|||.||:.:         .|  ..:|.   .|..:.::|:...|||:.|    
Zfish    93 RWMFEIGAVYLHGYDKEGNKL---------FWFKVKLHIKDPKTVLDKKRYVAFWLERYAK---- 144

  Fly   136 QSQKHGWRARQLVVFFDMQ-------DVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINA 193
              ::.|   ..|.|.|||.       |::..:|        :||..|.|   :|:.|....:...
Zfish   145 --REPG---MPLTVVFDMSESGLSNIDMDFVKY--------IISCFKVY---YPKFLSKMIMYEM 193

  Fly   194 PKLFSVAFNIVKKFLDENTTSKI-VIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCK 257
            |.:.:.|:.|||.:|..:..||: .:.||.:     |.|  |..:..|...||....:...|   
Zfish   194 PWIMNAAWKIVKTWLGPDAISKLKFVSKSDI-----QTF--VGPEHLPPYMGGTDQFKYSYP--- 248

  Fly   258 ALMVWGGKLPEELYIDQSS--------QQSDRDFVEAQVPKGDKLKLHFKV--NVEEQKILSWEF 312
                   .||::.:  ||.        .:.:.|..:|:....:.|:..|..  :::.:|:   .|
Zfish   249 -------PLPDDDF--QSPICENGPIISEDESDLKDAESESKETLESSFNTDQSIKPKKV---NF 301

  Fly   313 RTFDYDIKFGIYSVDDKTGEKRSEVPLGTVYSNEMDEIGYISTRPNTTY 361
            .|.|              |::..|:...:|....       :.:|.||:
Zfish   302 MTED--------------GQRSEELDRESVRLKG-------ARKPTTTF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/40 (33%)
SEC14 75..246 CDD:238099 45/183 (25%)
GOLD_2 303..381 CDD:290608 10/59 (17%)
mospd2NP_001007294.2 CRAL_TRIO 99..240 CDD:279044 43/176 (24%)
Motile_Sperm 333..437 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.