DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG11550

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:303 Identity:50/303 - (16%)
Similarity:117/303 - (38%) Gaps:69/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VRWLRARKWNLEAAEKMLRASLKTRA-----MWNVDNIEKWDPPKALQEYLPYGLMGYDNEGSPV 96
            :.:..|.::::|.|:::|..:|..|.     ..|:| .|:.:..:|::......|.|...||..|
  Fly    44 LHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLD-CERPEIRRAMRTVSIVPLPGATPEGYRV 107

  Fly    97 LVCPF-----ANFDMWGMM--HCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQ 154
            ::...     :|::...:|  :|:. |:|..|                 :.|.:...::|     
  Fly   108 ILAKLDDLNTSNYNFADVMKLYCMV-FDFWMY-----------------EDGIQPGHVIV----- 149

  Fly   155 DVNLKQYAWRPAAECVISTVKQY-----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTS 214
             ::||..:....|...:..:|::     ||....|:.. :.||..........::..|:.:..|:
  Fly   150 -IDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGF-HFINIVPFMDKILALMTPFMKKELTT 212

  Fly   215 KIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGGKLPEELY----IDQS 275
            .:.::..     .::.:..|.::..||.:||::.:.|              :.:|:|    :|..
  Fly   213 VLHMHSD-----LKEFYKFVPQEMLPKEYGGQLEEAN--------------VAKEIYYKKLLDNR 258

  Fly   276 SQQSDRDFVEAQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYD 318
            .:..:   .|.:....:||:.....|..:...:...|:..|.|
  Fly   259 KEMIE---FETRHQVNEKLRPGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 4/19 (21%)
SEC14 75..246 CDD:238099 29/182 (16%)
GOLD_2 303..381 CDD:290608 3/16 (19%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 28/174 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.