DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG10300

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:318 Identity:67/318 - (21%)
Similarity:117/318 - (36%) Gaps:86/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDYFLVRWLRARKWNLEAAEKMLRASLKTRAMW-------NVDNIEKWDPPKALQEYLPYG---- 85
            |:..::.:||..:::.|..::........|:::       .||        :||...|..|    
  Fly    49 DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVD--------EALLTQLQRGIHVI 105

  Fly    86 -LMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVV 149
             :.....||..|::..|.|.|   ......|..|:  |:.::...:.:..|.:...|     |:.
  Fly   106 PMRPVSPEGPRVIISQFRNID---PKKSNPREAFK--LIFIMLELLALECDNAAISG-----LIW 160

  Fly   150 FFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCY---------------IINAPKLFSV 199
            ..|.:||.::|             :.||:   |.|||..:               :||..|....
  Fly   161 VVDARDVTMEQ-------------MMQYD---PFLLKKAFALVDQCIPLRFVEIHMINMRKEGQT 209

  Fly   200 AFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGG 264
            .||.|.|||......|.|::|.     .|.|:.|:.|......:||    .|| .|.:|:..|..
  Fly   210 IFNFVTKFLPSKLPFKFVVHKK-----SEDLYQHLPRDVMTIEYGG----TNG-YQAEAVDHWRQ 264

  Fly   265 KLPEELYIDQSSQQSDRDFV--EAQVPKGDKLKLHFKVNVEEQKI--LSWEFRTFDYD 318
            ||.:           .:|::  :||....:||::.........::  :|..||..:.|
  Fly   265 KLLD-----------SKDYLAKDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 4/24 (17%)
SEC14 75..246 CDD:238099 43/190 (23%)
GOLD_2 303..381 CDD:290608 4/18 (22%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 42/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.