DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG10301

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster


Alignment Length:343 Identity:71/343 - (20%)
Similarity:130/343 - (37%) Gaps:87/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PEISEEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEK--------------MLRA 56
            |:..::...||..:.:|.......|..| ||:.:||..:::||..::              ::..
  Fly    21 PDRIQQDIIILRVWIRQQPHLRARTDVD-FLIAFLRRCRYSLEETKRRIDRYFTHYNLFPEIMNN 84

  Fly    57 SLKTRAMWNVDNIEKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFD--MWGMMHCVTRFEFQ 119
            ...|:.:.:::.:     ...|...:|.|     :..|.:.:..|.:||  :: |:..:..|...
  Fly    85 RCVTQRLLDINRM-----GVCLYPDMPKG-----DSRSAMFIARFGHFDPNLY-MLREIYHFSSM 138

  Fly   120 KYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVN----------LKQYAWRPAAECVISTV 174
            ...|:.||.      |.:...|     :....|::.||          |.:..|.....|     
  Fly   139 AMEVIALEN------DYASLAG-----ICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNC----- 187

  Fly   175 KQYEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAF 239
                  .|..:|..||||.||  .:...::  || .|..|..|.|...|.:..|:|..|:.:::.
  Fly   188 ------SPLKVKEMYIINMPK--DIQGTVM--FL-YNVLSMQVNYPIRVLKNSEELIEHIGKESL 241

  Fly   240 PKAWGGEMVDRNGD-PQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQVPKG--DKLKLHFKVN 301
            |:.:||    .||. .:|.|.|       |:|.      .|.|.:.|.....|  ::|: |.::.
  Fly   242 PEEYGG----TNGHLGECVAYM-------EDLL------NSYRGYFEQDCNYGTIEELR-HGEIA 288

  Fly   302 VEEQKI-LSWEFRTFDYD 318
            ..|.:. .:..||..::|
  Fly   289 TYEAEFGANGSFRRLNWD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 10/54 (19%)
SEC14 75..246 CDD:238099 40/182 (22%)
GOLD_2 303..381 CDD:290608 4/17 (24%)
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 11/46 (24%)
CRAL_TRIO 114..248 CDD:279044 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.