DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and rlbp1b

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:255 Identity:53/255 - (20%)
Similarity:110/255 - (43%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EEQRAILEKFRKQMDDALVGTHD------DYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDN 68
            :|.|.|:::..:..|:...|..|      |..|||::||||:::..|.::::..::.|.    |.
Zfish    64 KELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFRR----DY 124

  Fly    69 IEKWD--PPKALQEYLPYGLMGY----DNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLE 127
            .|.::  .|:|::..:..|..|.    |..|..||:....|:|    ...:|..|..:...::||
Zfish   125 PELFENLTPEAVRSTIEAGYPGILSSRDKYGRVVLLFNIENWD----YEEITFDEILRAYCVILE 185

  Fly   128 RFMKIAYDQSQKHGWRARQLVVFFDMQDVN------LKQYAWRPAAECVISTVKQYEANFPELLK 186
            :.::  .:::|.:|:...:....|.||..:      ||:            .|...:.:||...|
Zfish   186 KLLE--NEETQINGFCIIENFKGFTMQQASGIKPTELKK------------MVDMLQDSFPARFK 236

  Fly   187 MCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGE 246
            ..:.|:.|..|:..:|:||..:......::.::...:    |..|...:.:..|..:.|:
Zfish   237 AVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDL----ENYFKEFDAEILPSDFDGK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 12/46 (26%)
SEC14 75..246 CDD:238099 34/180 (19%)
GOLD_2 303..381 CDD:290608
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 15/52 (29%)
CRAL_TRIO 143..292 CDD:279044 32/170 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.