DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG10657

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster


Alignment Length:262 Identity:59/262 - (22%)
Similarity:108/262 - (41%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EISEEQ---RAILEKFRKQMDDALVGTH--------DDYFLVRWLRARKWNLEAAEKMLRASLKT 60
            |:.|::   |..|.:||:.::     .|        |..||:|:||.:|:::.:|.:||...|..
  Fly    42 ELHEDENIRRQALAQFREWIE-----KHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTI 101

  Fly    61 RAMWNVDNIEKW-------DPPKALQEYLPYG----LMGYDNEGSPVLVCPFANFDMWGMMHCVT 114
            |.::     .:|       ||  |:.|....|    |...|:.|..|:....|.||.:..    |
  Fly   102 RQLF-----PQWFKQLDINDP--AINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKF----T 155

  Fly   115 RFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYA-WRPAAECVISTVKQYE 178
            ..:..:...|:.|..:.  .:.||..|:     |...|...:|:...: |  :...:.|.||..:
  Fly   156 SVQMARVHSLVCEALLD--DEDSQVAGY-----VYINDESGMNMGFVSLW--SLTDLRSIVKCIQ 211

  Fly   179 ANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAW 243
            .:.|...|..:.:|.|...:....:....|.:....:|:::|: ||    .|.:.::....||.:
  Fly   212 NSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVHKN-VD----ILKTKIDPAILPKEY 271

  Fly   244 GG 245
            ||
  Fly   272 GG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 14/48 (29%)
SEC14 75..246 CDD:238099 37/176 (21%)
GOLD_2 303..381 CDD:290608
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 14/50 (28%)
CRAL_TRIO 126..274 CDD:279044 35/166 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.