DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and sec14l1

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_957392.1 Gene:sec14l1 / 394073 ZFINID:ZDB-GENE-040426-801 Length:697 Species:Danio rerio


Alignment Length:328 Identity:78/328 - (23%)
Similarity:157/328 - (47%) Gaps:32/328 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QRAILEKFRKQMDDALVGTH-----DDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVD-NIE 70
            |.:.|.:.|:.:.:    ||     .|..::|:||:|.:|||.|::.|..:|..|....:| .::
Zfish   237 QESCLIRLRQWLQE----THKGKIPKDQHVLRFLRSRDFNLEKAKEALCQTLTWRKQHQIDFLLD 297

  Fly    71 KWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLERFMKIAYD 135
            .|..|:.||:|...|...:|.:|.|:.:......|..|::..:......::::.:.|..::...:
Zfish   298 TWQSPQPLQDYYTGGWHHHDKDGRPLYILRLGQMDTKGLVRALGEETLLRHVLSINEEGLRRCEE 362

  Fly   136 QSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSVA 200
            .::..|..........|::.:|:: :.|||..:.::..::...||:||.|....|:.||::|.|.
Zfish   363 NTKIFGKPISCWTCLVDLEGLNMR-HLWRPGIKALLRMIEVVGANYPETLGRLLILRAPRVFPVL 426

  Fly   201 FNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGGK 265
            :.:|..|:||||..|.:||.....:....|..::|:...|...|       ||..|.  :..||.
Zfish   427 WTLVSPFIDENTRKKFLIYAGNDYQGPGGLVDYINKDCIPDFLG-------GDSMCD--IPEGGL 482

  Fly   266 LPEELYIDQSSQQSDRDFVE---------AQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYDIKF 321
            :|:.||  :::::.:.:.|:         |.|.||...::..:: .:...:::|:|.....|:.|
Zfish   483 VPKSLY--RTAEELENEEVKLWNETIYKSASVLKGAPHEVLIEI-TDVSSVITWDFDVCKGDMIF 544

  Fly   322 GIY 324
            .||
Zfish   545 NIY 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 14/45 (31%)
SEC14 75..246 CDD:238099 40/170 (24%)
GOLD_2 303..381 CDD:290608 6/22 (27%)
sec14l1NP_957392.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 238..283 CDD:215024 14/48 (29%)
CRAL_TRIO 308..472 CDD:279044 37/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.