DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG33523

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:226 Identity:52/226 - (23%)
Similarity:94/226 - (41%) Gaps:44/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIEKWDPPKALQEYLPYG---LMGYDNE 92
            :|..:|.|:|.....::|.:...|..:...|.....::|   |..:..||||..|   :...|.:
  Fly    43 NDHLWLQRFLEMYDLDMETSFNSLWETCILRQSTGANDI---DESELNQEYLKEGSVFVHNTDVD 104

  Fly    93 GSPVLVCPFANFDMWGMMHCVTR--FEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQD 155
            |.|:||     |.:  .||..::  .|..:.:|..:||      .|.::|   ..||.:||||..
  Fly   105 GKPLLV-----FRV--KMHSKSKNLDELIRIVVYWVER------TQREQH---LTQLTIFFDMSG 153

  Fly   156 VNLK----QYAWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKI 216
            .:|.    ::..|     ::.|.||:   :|..|....:.....:.:.||.::|..|.......:
  Fly   154 TSLASMDLEFVKR-----IVETFKQF---YPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEIL 210

  Fly   217 -VIYKSGVDRWQEQLFSHVNRKAFPKAWGGE 246
             :|.|..:::       ::|:......||||
  Fly   211 KMISKKDINQ-------YINKDNCLAIWGGE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 6/25 (24%)
SEC14 75..246 CDD:238099 41/180 (23%)
GOLD_2 303..381 CDD:290608
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 37/170 (22%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.