DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG32407

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:256 Identity:55/256 - (21%)
Similarity:101/256 - (39%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLPE-ISEEQRAILEKFRKQ-------MDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKT 60
            |.|| ||:.:.:||::..|:       .:|....|..|.::.:.|:...:::|.....|..:|..
  Fly     7 PTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAW 71

  Fly    61 RAMWNVDNIEKWDPPKALQEYLPYG---LMGYDNEGSPVLVCPFANFDMWGMMHCVTR--FEFQK 120
            |..:.|.:|.:   ....||:|..|   :...|.:|.|:|:.....       |..:|  .:..:
  Fly    72 RKSFGVYDITE---ANLNQEFLNDGSIYVHNKDRDGKPLLILTIKK-------HSKSRNQEDLLR 126

  Fly   121 YLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELL 185
            .||..:||..:.:         ...::.:|.||....|...    ....:.|.:..:|..:|.:.
  Fly   127 ILVFWIERLQRDS---------NLDKITIFMDMTGAGLSNL----DMGFIKSIIGVFETKYPYVP 178

  Fly   186 KMCYIINAPKLFSVAFNIVKKFLDENTTSKI-VIYKSGVDRWQEQLFSHVNRKAFPKAWGG 245
            ....:.:.|.|...||.:||.||.......: |..|..:|:       :|::....|.|||
  Fly   179 NYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDIDQ-------YVDKDNCLKIWGG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 8/47 (17%)
SEC14 75..246 CDD:238099 37/177 (21%)
GOLD_2 303..381 CDD:290608
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/168 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.