DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Cralbp

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:334 Identity:64/334 - (19%)
Similarity:112/334 - (33%) Gaps:109/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIEKWDPPKALQEYLPYGLMGYDNEGSPV 96
            ||.||:|:|||:|:::..||:.|...|         ||.:..|                      
  Fly    53 DDTFLLRFLRAKKFSVPMAEQTLLKY
L---------NIRRTFP---------------------- 86

  Fly    97 LVCPFANFDMWGMMHCVTRFEF-QKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQ 160
                          |..|:.:: :..|..|:::....|..|..|||.|    ||..:.:.:|.|.
  Fly    87 --------------HMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRR----VVVINAKGLNPKI 133

  Fly   161 YA------------------------------------------WRPAAECVISTVKQYEANFPE 183
            :.                                          |.|.....|  .|..|.:.|.
  Fly   134 HTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARI--FKWGEQSLPM 196

  Fly   184 LLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMV 248
            ..|..::||.|.......:.||..:.....::::||.|     :::|...|::...|...||:: 
  Fly   197 RHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS-----EKELMKSVDQGCLPLEMGGKV- 255

  Fly   249 DRNGDPQCKALMVWGGKLPEE----LYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVNVEEQKILS 309
                 |..:.:.:|..:|..:    |.:|:|..:|||...........|........|.:.:.:.
  Fly   256 -----PMREMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIE 315

  Fly   310 WEFRTFDYD 318
            ..||..::|
  Fly   316 GSFRKLEFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 12/24 (50%)
SEC14 75..246 CDD:238099 33/213 (15%)
GOLD_2 303..381 CDD:290608 3/16 (19%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 12/24 (50%)
SEC14 101..254 CDD:238099 30/163 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.