DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Clvs1

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001102439.1 Gene:Clvs1 / 366311 RGDID:1564200 Length:354 Species:Rattus norvegicus


Alignment Length:266 Identity:59/266 - (22%)
Similarity:118/266 - (44%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGPLPEISEEQRA-------ILEKFRKQMDDALVG-------THDDYFLVRWLRARKWNLEAAEK 52
            :|..|:..|:.|.       :|.:..:|:.|.::.       ..||.|::|:|||||::...|.:
  Rat    28 AGLSPDTIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFR 92

  Fly    53 MLRASLKTRAMWNVD---NIEKWDP--PKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHC 112
            :|....:.|.: |:|   |.:..||  .:||.:..|..|...|:.|..:|:...||:|.      
  Rat    93 LLAQYFQYRQL-NLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQ------ 150

  Fly   113 VTRFEFQKYL-VLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQ 176
             :|..|...| .:||...:.|...:.|.:|:     ::..|..:.:.|| |.:.....:...::.
  Rat   151 -SRNSFTDILRAILLSLEVLIEDPELQINGF-----ILIIDWSNFSFKQ-ASKLTPSILKLAIEG 208

  Fly   177 YEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPK 241
            .:.:||......:.:|.|......:.::|.||.:.|..:|.::.:.::    .|...::.:..|.
  Rat   209 LQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLN----SLHQLIHPEFLPS 269

  Fly   242 AWGGEM 247
            .:||.:
  Rat   270 EFGGTL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 14/47 (30%)
SEC14 75..246 CDD:238099 34/171 (20%)
GOLD_2 303..381 CDD:290608
Clvs1NP_001102439.1 CRAL_TRIO_N 51..97 CDD:215024 13/45 (29%)
CRAL_TRIO 125..274 CDD:395525 32/165 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.