DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Sec14l1

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:378 Identity:92/378 - (24%)
Similarity:175/378 - (46%) Gaps:45/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPEISEEQRAILEKFRKQMDDALVGTH-----DDYFLVRWLRARKWNLEAAEKMLRASLKTRAMW 64
            |.:::..|.:.|.:.|:.:.:    ||     .|..::|:||||.:|::.|.:::..||..|...
  Rat   249 LGDLTPLQESCLIRLRQWLQE----THKGKIPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQH 309

  Fly    65 NVDNI-EKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLER 128
            .||.| :.|.||:.||:|...|...:|.:|.|:.|......|..|::..:......:|::.:.|.
  Rat   310 QVDYILDTWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEE 374

  Fly   129 FMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINA 193
            .::...:.::..|..........|::.:|:: :.|||..:.::..::..|||:||.|....|:.|
  Rat   375 GLRRCEENTKVFGRPISSWTCLVDLEGLNMR-HLWRPGVKALLRIIEVVEANYPETLGRLLILRA 438

  Fly   194 PKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKA 258
            |::|.|.:.:|..|:|:||..|.:||.....:....|..:::::..|....||         |..
  Rat   439 PRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE---------CMC 494

  Fly   259 LMVWGGKLPEELYIDQSSQQSDRD---------FVEAQVPKGDKLKLHFKVNVEEQKILSWEFRT 314
            .:..||.:|:.||  ::.::.:.:         :..|.|.||...::..:: |:...:::|:|..
  Rat   495 DVPEGGLVPKSLY--RTPEELENEDLKLWTETIYQSASVFKGAPHEILIQI-VDAASVITWDFDV 556

  Fly   315 FDYDIKFGIYSVDDKTGEKRSEVPLGTVYSNEMDEIGYIS-TRPNTTYTVVFD 366
            ...||.|.||.      .|||..|      .:.|.:|..| |.|......:.|
  Rat   557 CKGDIVFNIYH------SKRSPQP------PKKDSLGAHSITSPGGNNVQLID 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 12/45 (27%)
SEC14 75..246 CDD:238099 40/170 (24%)
GOLD_2 303..381 CDD:290608 17/65 (26%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 12/48 (25%)
CRAL_TRIO 327..491 CDD:279044 37/164 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.