DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG12926

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:363 Identity:73/363 - (20%)
Similarity:113/363 - (31%) Gaps:121/363 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GPLPE-ISEEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLE------------------ 48
            |.:|: |.|:...:.....||  ..|....|..|||.:||..|::||                  
  Fly    25 GEIPDRIDEDIETLRTWISKQ--PHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPE 87

  Fly    49 ------AAEKMLRASLKTRAMWNVDNIEKWDPPKA-LQEYLPYGLMGYD---------------- 90
                  ..||.| :.|.|..:..:....:.|.|:. :..|..|....|.                
  Fly    88 LYKNRIVGEKQL-SILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEVVQVNTMLGEIQI 151

  Fly    91 NEGSPVLVCPFAN-FDMWGM--MHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFD 152
            .|....::..|.. .||.|:  .|.   |:|...||                     ::|.|..|
  Fly   152 REDDNAMISGFVEIIDMKGVGAGHL---FQFDAVLV---------------------KKLAVLGD 192

  Fly   153 MQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIV 217
                  |.|.:||                    |..:.:|||.......:|.|..:.|....:..
  Fly   193 ------KAYPYRP--------------------KGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFH 231

  Fly   218 IYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRD 282
            |:..     .:.|:.:|.::..|..:||.    ||..| ..:..|..||           .:.:.
  Fly   232 IHSK-----LDSLYKYVPKECLPAEYGGS----NGTIQ-DVVSTWRTKL-----------LAYKP 275

  Fly   283 FVEAQVPKG--DKLKLHFKVNVEEQKILSWEFRTFDYD 318
            |.|.:...|  :||:....|:.|....:...||..|.|
  Fly   276 FFEEEASYGTNEKLRRGQPVSAESLFGIEGSFRKLDID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 15/64 (23%)
SEC14 75..246 CDD:238099 33/190 (17%)
GOLD_2 303..381 CDD:290608 5/16 (31%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 13/46 (28%)
SEC14 117..254 CDD:238099 33/191 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.