DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG1902

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:392 Identity:83/392 - (21%)
Similarity:121/392 - (30%) Gaps:148/392 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PEISEEQR-----------AILEKFRKQMDDA--LVGTHDDYFLVRWLRARKWNLEAAEKML--- 54
            ||::|..|           |.:|..|..:|..  |....||.|||.:||..:|::|.|:|.:   
  Fly     9 PELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFY 73

  Fly    55 -------RASLKTRAMWNVDN--IEKWDP------PKALQEYLP---YGLMGYDNEGSPVLVCPF 101
                   |..||.|   .||:  ||....      ||.:....|   |..||: .|.|...|...
  Fly    74 YTYKSKERELLKGR---QVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGH-IEPSKHSVSDI 134

  Fly   102 ANF------------DMWGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQ 154
            ..|            |.|.:...|...:|.|....||.:|....:          :::..|.   
  Fly   135 FRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMF----------KRMNAFL--- 186

  Fly   155 DVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIY 219
                                   |...|..|...:|:||.:.......:|:..:.:         
  Fly   187 -----------------------EHGIPANLVATHIVNASRETQFVLGLVRNVMKQ--------- 219

  Fly   220 KSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFV 284
                   :|.|..|....:..||.|.|.                  ||.|:              
  Fly   220 -------KELLHIHSTVASLRKAIGLEY------------------LPVEM-------------- 245

  Fly   285 EAQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYDIKFGIYSVDDK---TGEKRSE--VPLGTVYS 344
                 .||...|...:...|.::||:. ..|..|.::|   ||:|   ..||..|  .||.|...
  Fly   246 -----GGDNGSLSDAMTRYETQLLSFS-PYFTEDERYG---VDEKLREASEKDQERGAPLVTDVP 301

  Fly   345 NE 346
            |:
  Fly   302 ND 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 16/52 (31%)
SEC14 75..246 CDD:238099 32/185 (17%)
GOLD_2 303..381 CDD:290608 16/49 (33%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 15/40 (38%)
CRAL_TRIO 100..248 CDD:279044 36/237 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.