DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG10026

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:255 Identity:59/255 - (23%)
Similarity:102/255 - (40%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EISEEQRAILEKFRK---QMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDN 68
            |....:..::|:||.   :.::......|..:|.::||||.|.:|.:.|:|.:..:.|.. |...
  Fly    37 ECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQ-NKSF 100

  Fly    69 IEKWDP-------PKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVL-- 124
            .||..|       ...:....||    .|..|..:|:   ..|.:|..........|:..:||  
  Fly   101 YEKVRPLDLRHVGQSDILTVTPY----RDQHGHRILI---YRFGLWRPNQVTVDDIFRATIVLQE 158

  Fly   125 --LLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQ--YAWRPAAECVISTVKQYEANFPELL 185
              .||...:|...            |..||::|:.|:.  :.....|:.:|:.:   ..:.|...
  Fly   159 LGSLEPISQIVGG------------VGIFDLKDLGLEHILHLSPSVAQKMIALL---VTSMPIRT 208

  Fly   186 KMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGG 245
            ...:|:|...:|:.||.|.|.||:.....|:.|:.|.:    ..|..|:|.:..||.:||
  Fly   209 SALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDM----TSLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/43 (30%)
SEC14 75..246 CDD:238099 40/177 (23%)
GOLD_2 303..381 CDD:290608
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 13/46 (28%)
SEC14 112..265 CDD:238099 40/179 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.