DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG3823

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:227 Identity:49/227 - (21%)
Similarity:84/227 - (37%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LVRWLRARKWNLEAAEKMLRASLKTR---AMWNVDNIEKWDPPKALQEYL-------PYGLMGYD 90
            |.|:|...:.:|.||:::|..:...|   |...:|.    ||..|..:.|       |  |.|..
  Fly    39 LRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDR----DPLDASSQQLLQVADLVP--LPGLT 97

  Fly    91 NEGSPVLVCPFANFDMWGMMHCVTRFEFQKYL-VLLLERFMKIAYDQSQKHGWRARQLVVFFDMQ 154
            .|.:.:|.....:||       ..:|.|...: |..:....:.|.:..::   .:...:..|||.
  Fly    98 PENNKLLFYRLIDFD-------ADKFNFTAAIKVFFMVADCRFATENEER---LSDGEIPVFDMA 152

  Fly   155 DVNLKQYAWRPAAECVISTVKQY-----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTS 214
            .     |..|...:..:..::.|     ||: |..||..:::|.|........:||.|:......
  Fly   153 G-----YTLRHLTKTALGALRVYMKFVQEAH-PVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFK 211

  Fly   215 KIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGE 246
            .|..:....|    ..:.|..|...|:.:|||
  Fly   212 LIHFHLPNAD----TPYRHFPRSMLPEEYGGE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 7/20 (35%)
SEC14 75..246 CDD:238099 35/183 (19%)
GOLD_2 303..381 CDD:290608
CG3823NP_572313.1 SEC14 90..239 CDD:238099 33/170 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.