DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG3091

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:99 Identity:25/99 - (25%)
Similarity:44/99 - (44%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 DMQDVNLKQYAWRPAAECVISTVKQY----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENT 212
            |:|.|::..|..|..|...|..::.|    :..:|..|:..::||.|.......:::..||.|..
  Fly   168 DVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEV 232

  Fly   213 TSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGE 246
            .:.|..:..|:|    .|:..|.|...|..:||:
  Fly   233 RNMIRYHTEGMD----SLYKEVPRDMLPNEYGGK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024
SEC14 75..246 CDD:238099 24/97 (25%)
GOLD_2 303..381 CDD:290608
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.