DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG3191

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:273 Identity:59/273 - (21%)
Similarity:105/273 - (38%) Gaps:50/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGPLPEISEEQ----------------RAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAA 50
            ||...::..||                :.:||.||:  :|.|....|...|.|:.:....::|..
  Fly    12 SGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEET 74

  Fly    51 EKMLRA--SLKTRAMWNVDNIEKWDPPKA-------LQEYLPYGLMGYDNEGSPVLVCPFANFDM 106
            .|::..  :|:.|   :.....|.||..|       ..:.||  |.|...:...|.:..|..|:.
  Fly    75 RKLIEVNYALRNR---HPHLFIKRDPLDADSKRTFDYADILP--LPGLTPDKCKVSLYCFREFEA 134

  Fly   107 WGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVI 171
            ..|.|..   :.:.:.::...||  :..|...|....:...|..|||:...:     |..:...|
  Fly   135 SKMHHTE---DTRAFFMVSDCRF--VTPDDLAKPDVLSEGEVQIFDMKGTTM-----RHISRLTI 189

  Fly   172 STVKQY----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFS 232
            ||::.|    :..||..|:..::||.|.......::||.|:.:.....|..:...::    .|:.
  Fly   190 STLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSIN----TLYE 250

  Fly   233 HVNRKAFPKAWGG 245
            .|.|:..|:.:||
  Fly   251 FVPREMLPEEYGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 11/42 (26%)
SEC14 75..246 CDD:238099 39/182 (21%)
GOLD_2 303..381 CDD:290608
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 34/162 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.