DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Ttpal

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:302 Identity:80/302 - (26%)
Similarity:131/302 - (43%) Gaps:61/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWN--VDNIEKWDPP 75
            :|:.:..||:. ..|..:.||.||:|:|||||::.:.|.::|......|..|.  ..|:.    |
  Rat    60 QALRDMVRKEY-PYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCRRSWPEVFSNLR----P 119

  Fly    76 KALQEYLPYGLMGY----DNEGSPVL-VCPFANFDMW-GMMHCVTRFEFQKYLVLLLERFMKIAY 134
            .||::.|..|.:..    |..|..|| :.|    |.| ...:.:|  |..:.:.|.||:.  |..
  Rat   120 SALKDVLNSGFLTVLPHTDPRGCHVLCIRP----DRWIPSNYPIT--ENIRAIYLTLEKL--IQS 176

  Fly   135 DQSQKHGWRARQLVVFFDMQDVNL-KQYAWRP-AAECVISTVKQYEANFPELLKMCYIINAPKLF 197
            :::|.:|     :|:..|.:.|:| |...:.| .|..||..::.   .||..:|..:|:|.|::|
  Rat   177 EETQVNG-----VVILADYKGVSLSKASHFGPFIARKVIGILQD---GFPIRIKAVHIVNEPRIF 233

  Fly   198 SVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGG----------------- 245
            ...|.|:|.||.|...::..::.|.:    ..|.:.:.|...||.:||                 
  Rat   234 KGIFAIIKPFLKEKIANRFFLHGSDL----SSLHTSLPRNILPKEYGGTAGELDTASWNAVLLAS 294

  Fly   246 --EMVDRNGDPQ--CKALMVWGGK--LPEELYIDQSSQQSDR 281
              :.|.....|:  |..|:   |:  |||.|..|.....|.|
  Rat   295 EDDFVKEFCQPESGCDGLL---GQPLLPEGLISDAQCDDSMR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 15/40 (38%)
SEC14 75..246 CDD:238099 49/197 (25%)
GOLD_2 303..381 CDD:290608
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 16/43 (37%)
SEC14 122..278 CDD:238099 46/175 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.